PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D06G1002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 979aa    MW: 108196 Da    PI: 5.2637
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D06G1002genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-163985148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+ Ed++l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
      Gh_D06G1002 39 KGQWTAAEDDILSKAVQRFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 85
                     799****************************9.************986 PP

2Myb_DNA-binding66.35.6e-2191137148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEdel++++v+++G++ W+tIa++++ gR +kqc++rw+++l
      Gh_D06G1002  91 KGPWSKEEDELIIELVNKYGPKKWSTIAQHLP-GRIGKQCRERWHNHL 137
                      79******************************.*************97 PP

3Myb_DNA-binding48.52e-15143185145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r +WT+eE++ lv+a++ +G++ W+   + ++ gRt++ +k++w+
      Gh_D06G1002 143 REAWTQEEELALVRAHQIFGNR-WAELTKFLP-GRTDNAIKNHWN 185
                      789*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.7013485IPR017930Myb domain
SuperFamilySSF466891.36E-143592IPR009057Homeodomain-like
SMARTSM007171.2E-133887IPR001005SANT/Myb domain
PfamPF002492.7E-143985IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-204092IPR009057Homeodomain-like
CDDcd001673.63E-124285No hitNo description
PROSITE profilePS5129434.00586141IPR017930Myb domain
SuperFamilySSF466891.87E-3188184IPR009057Homeodomain-like
SMARTSM007174.5E-2090139IPR001005SANT/Myb domain
PfamPF002491.4E-1991137IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.6E-2893139IPR009057Homeodomain-like
CDDcd001671.18E-1793137No hitNo description
Gene3DG3DSA:1.10.10.604.9E-21140192IPR009057Homeodomain-like
SMARTSM007171.2E-14142190IPR001005SANT/Myb domain
PROSITE profilePS5129418.759142192IPR017930Myb domain
PfamPF002494.3E-13143186IPR001005SANT/Myb domain
CDDcd001672.38E-11145185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 979 aa     Download sequence    Send to blast
MESDIKVSTP SVGLGSSDGA QRIRPVHGRT SGPTRRSTKG QWTAAEDDIL SKAVQRFKGK  60
NWKKIAECFK DRTDVQCLHR WQKVLNPELV KGPWSKEEDE LIIELVNKYG PKKWSTIAQH  120
LPGRIGKQCR ERWHNHLNPS INREAWTQEE ELALVRAHQI FGNRWAELTK FLPGRTDNAI  180
KNHWNSSVKK KLDSYIASGL LEQLQFPVLA NQSQPMPSSS LRMQSTVDDS GAKCRKESED  240
ISECSQESNM IGCSQSASDL ATAAVHTREQ FHLTEMPGVS KERNSSSAPC SEEYYPSFED  300
VNFSIPEIPC EVGYSSSGDY QFGGHMLITD DECCRVLFSE AVNDGCFASE NFTQGSNIVE  360
LGGCTNISLC QPSDIQPSET GKTPASQSGL PSRSEVLPTS CCQSFASPSL LSVEDGTLMY  420
GQEQSQLNCQ PFGTQEQEFT MNAHDGFIFT NDDHTNDTDL QEQTYLAKDS QKLVSVNSIG  480
SELSAMLTCP IADDKRNLPV EEDVRGLCYE PPRFPSLDVP FFSCDLVPSG GNMQQEYSPL  540
GIRQLMMSSM NCISPFRLWD SPSRDGSPDA VLKSAAKTFT GTPSILKKRH RDLLSPLSER  600
RREKKLEIDM TSSLTKDFSR LDVMFDESVT GNTSQVSPSK RKTNARTSIE EKENVYQEFH  660
GSLDNGGEYT EPIDDEAQKK DSNGTNSPGN IKKEAWGIDI KDKTDAHASE KIIQQPSAVL  720
IEHNVNDLLL FSPDRVGLKA DQPLLPSSIR TPRSQCHKSF RAISNQGLSG NACLIVSSPT  780
LKVKNSDGHS ISVTAVQCTN SPATLENLAD NAGIDTAIEN YNIFGGTPFR RSIESPSAWK  840
SPWFINSFIP GPRIDTEITI EDIGYVMSPA ERSYDAIGLI KQLSEHTAAA YADALEVLGN  900
ETPKSIVKGR LSNNRNMDKE NNGVENSSHL TSNILAERRI LDFSECETPR KETENGKSST  960
TAATVSFSSP SSYLLKGCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C7e-69391926159MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-69391926159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1598605ERRREKKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.161090.0boll| ovule| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012450682.10.0PREDICTED: uncharacterized protein LOC105773388
RefseqXP_012450681.10.0PREDICTED: uncharacterized protein LOC105773388
RefseqXP_012450680.10.0PREDICTED: uncharacterized protein LOC105773388
SwissprotQ9S7G71e-125MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A0D2SQU60.0A0A0D2SQU6_G
STRINGPOPTR_0006s25840.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46742649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.10.0myb domain protein 3r-4